Product Description
Size: 20ul / 150ul
The NMES1 (25102-1-AP) by Proteintech is a Polyclonal antibody targeting NMES1 in WB, ELISA applications with reactivity to human, mouse samples
25102-1-AP targets NMES1 in WB, ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive WB detected in: human testis tissue, mouse colon tissue, mouse testis tissue
Recommended dilution
Western Blot (WB): WB : 1:2000-1:10000
Background Information
Nmes1, encoding for Normal Mucosa of Esophagus-Specific gene 1, also known as C15orf48, Modulator of Cytochrome C Oxidase during Inflammation [MOCCI]), was first identified in a study of human esophageal squamous cell carcinoma (ESCC) tissues (PMID: 30013631). Nmes1 is expressed in epithelial tissue and is believed to be a tumor suppressor gene. Nmes1 encodes for a small protein consisting of 83 amino acid and is a nuclear protein (PMID: 37971166).
Specification
Tested Reactivity: human, mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag18744 Product name: Recombinant human C15orf48 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 3-83 aa of BC021173 Sequence: FFQLLMKRKELIPLVVFMTVAAGGASSFAVYSLWKTDVILDRKKNPEPWETVDPTVPQKLITINQQWKPIEELQNVQRVTK Predict reactive species
Full Name: chromosome 15 open reading frame 48
Calculated Molecular Weight: 83 aa, 9 kDa
Observed Molecular Weight: 10 kDa
GenBank Accession Number: BC021173
Gene Symbol: C15orf48
Gene ID (NCBI): 84419
RRID: AB_3669463
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q9C002
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924