Proteintech, 25105-1-AP, NHE2 Polyclonal antibody

Size: 20ul / 150ul The NHE2 (25105-1-AP) by Proteintech is a Polyclonal antibody targeting NHE2 in WB, ELISA applications with reactivity to human, mouse, rat samples 25105-1-AP targets NHE2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, rat brain tissue, mouse stomach tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information NHE2, also known as SLC9A2, is a protein-coding gene mainly at the top of gastrointestinal epithelial cells. It mainly encodes a member of the sodium-hydrogen exchanger (NHE) protein family, which is localized to the apical membrane and is easily degraded by lysosomes, resulting in a short half-life. NHE2 is involved in sodium ion transport by exchanging intracellular hydrogen ions into external sodium ions, and helps in the regulation of cell pH and volume to eliminate acids produced by active metabolism or against adverse environmental conditions. NHE2 is widely distributed in tissues of the gastrointestinal tract, kidney, heart, testes, uterus, and adrenal glands (PMID: 37688782). The observed molecular weight of NHE2 is 70 kDa, which might be the unmodified form of NHE2 (PMID: 10444453, 10666043). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18801 Product name: Recombinant human SLC9A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 686-812 aa of BC136377 Sequence: ISIADGNSSDSDADAGTTVLNLQPRARRFLPEQFSKKSPQSYKMEWKNEVDVDSGRDMPSTPPTPHSREKGTQTSGLLQQPLLSKDQSGSEREDSLTEGIPPKPPPRLVWRASEPGSRKARFGSEKP Predict reactive species Full Name: solute carrier family 9 (sodium/hydrogen exchanger), member 2 Calculated Molecular Weight: 812 aa, 92 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC136377 Gene Symbol: NHE2/SLC9A2 Gene ID (NCBI): 6549 RRID: AB_3085771 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UBY0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.