Iright
BRAND / VENDOR: Proteintech

Proteintech, 25108-1-AP, NYAP2 Polyclonal antibody

CATALOG NUMBER: 25108-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The NYAP2 (25108-1-AP) by Proteintech is a Polyclonal antibody targeting NYAP2 in WB, ELISA applications with reactivity to human, mouse samples 25108-1-AP targets NYAP2 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19004 Product name: Recombinant human KIAA1486 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 50-145 aa of BC131727 Sequence: RNETNLAYLKEKNEKRRRQEEAIKRINRGTESPKPQHGAITKVGQQGKRPPWGVFLQRACQSSGMGWNTRATCGHQSTRKMLCEPHLVSGKPQFRA Predict reactive species Full Name: KIAA1486 protein Calculated Molecular Weight: 653 aa, 71 kDa Observed Molecular Weight: 80 kDa GenBank Accession Number: BC131727 Gene Symbol: NYAP2 Gene ID (NCBI): 57624 RRID: AB_2879900 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9P242 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924