Iright
BRAND / VENDOR: Proteintech

Proteintech, 25109-1-AP, MGAT4A Polyclonal antibody

CATALOG NUMBER: 25109-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The MGAT4A (25109-1-AP) by Proteintech is a Polyclonal antibody targeting MGAT4A in WB, IHC, ELISA applications with reactivity to human samples 25109-1-AP targets MGAT4A in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells Positive IHC detected in: mouse small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information MGAT4A (alpha-1,3-mannosylglycoprotein 4-beta-N-acetylglucosaminyltransferase A) is a key enzyme that catalyzes the formation of a specific branch on N-linked glycans (the transfer of β1,4-GlcNAc to the α1,3-mannose arm), belonging to the glycosyltransferase family. It is responsible for trimming and remodeling N-glycans in the Golgi apparatus to generate tissue- and disease-specific N-glycan structures. MGAT4A and MGAT4B are isoenzymes that catalyze the transfer of GlcNAc via a β1-4 linkage to the α1-3 linked mannose of the N-glycan core, thereby regulating glycoprotein maturation and function. This enzyme is involved in immunoglobulin G glycosylation, insulin receptor signaling, and neural cell adhesion molecule function. Deficiency of MGAT4A leads to decreased IgG galactosylation and enhanced pro-inflammatory activity, which is associated with an increased risk of autoimmune diseases such as rheumatoid arthritis and IgA nephropathy. Concurrently, it affects insulin secretion in pancreatic β-cells, highlighting its dual role in metabolic regulation and immune homeostasis. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18956 Product name: Recombinant human MGAT4A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 395-505 aa of BC127107 Sequence: EVSTSLKVYQGHTLEKTYMGEDFFWAITPIAGDYILFKFDKPVNVESYLFHSGNQEHPGDILLNTTVEVLPFKSEGLEISKETKDKRLEDGYFRIGKFENGVAEGMVDPSL Predict reactive species Full Name: mannosyl (alpha-1,3-)-glycoprotein beta-1,4-N-acetylglucosaminyltransferase, isozyme A Calculated Molecular Weight: 535 aa, 62 kDa Observed Molecular Weight: 68 kDa GenBank Accession Number: BC127107 Gene Symbol: MGAT4A Gene ID (NCBI): 11320 RRID: AB_2879901 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UM21 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924