Product Description
Size: 20ul / 150ul
The DNAJB13 (25118-1-AP) by Proteintech is a Polyclonal antibody targeting DNAJB13 in WB, IHC, ELISA applications with reactivity to human, mouse, rat, canine samples
25118-1-AP targets DNAJB13 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat, canine samples.
Tested Applications
Positive WB detected in: mouse testis tissue, rat testis
Positive IHC detected in: mouse testis tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:2000-1:12000
Immunohistochemistry (IHC): IHC : 1:1000-1:4000
Specification
Tested Reactivity: human, mouse, rat, canine
Cited Reactivity: human, mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag18934 Product name: Recombinant human DNAJB13 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 204-316 aa of BC153176 Sequence: PNIIPADIIFIVKEKLHPRFRRENDNLFFVNPIPLGKALTCCTVEVRTLDDRLLNIPINDIIHPKYFKKVPGEGMPLPEDPTKKGDLFIFFDIQFPTRLTPQKKQMLRQALLT Predict reactive species
Full Name: DnaJ (Hsp40) related, subfamily B, member 13
Calculated Molecular Weight: 316 aa, 36 kDa
Observed Molecular Weight: 32-36 kDa
GenBank Accession Number: BC153176
Gene Symbol: DNAJB13
Gene ID (NCBI): 374407
RRID: AB_2879906
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P59910
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924