Proteintech, 25138-1-AP, CCDC12 Polyclonal antibody

Size: 20ul / 150ul The CCDC12 (25138-1-AP) by Proteintech is a Polyclonal antibody targeting CCDC12 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human samples 25138-1-AP targets CCDC12 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, Raji cells Positive IP detected in: HeLa cells Positive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information CCDC12 is a 166aa protein with MW 18-25 kDa (with some modification). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18223 Product name: Recombinant human CCDC12 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-166 aa of BC020830 Sequence: MEATTAGVGRLEEEALRRKERLKALREKTGRKDKEDGEPKTKHLREEEEEGEKHRELRLRNYVPEDEDLKKRRVPQAKPVAVEEKVKEQLEAAKPEPVIEEVDLANLAPRKPDWDLKRDVAKKLEKLKKRTQRAIAELIRERLKGQEDSLASAVDAATEQKTCDSD Predict reactive species Full Name: coiled-coil domain containing 12 Calculated Molecular Weight: 166 aa, 19 kDa Observed Molecular Weight: 18-25 kDa GenBank Accession Number: BC020830 Gene Symbol: CCDC12 Gene ID (NCBI): 151903 RRID: AB_2879919 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WUD4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.