Proteintech, 25145-1-AP, SYPL1 Polyclonal antibody

Size: 20ul / 150ul The SYPL1 (25145-1-AP) by Proteintech is a Polyclonal antibody targeting SYPL1 in WB, ELISA applications with reactivity to human, mouse samples 25145-1-AP targets SYPL1 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information Synaptophysin-like 1 (pantophysin, SYPL1), a neuroendocrine-related protein, is abundant in adipocytes and is found in cellular membrane compartments overlapping with those containing the insulin-sensitive glucose transporter type 4 (GLUT4) .SYLP1, which is also found in both neuronal and non-neuronal tissues, plays an important role in inflammation, tumor proliferation, and progression. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18482 Product name: Recombinant human SYPL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 33-92 aa of BC020938 Sequence: CGGFKGQTEIQVNCPPAVTENKTVTATFGYPFRLNEASFQPPPGVNICDVNWKDYVLIGD Predict reactive species Full Name: synaptophysin-like 1 Calculated Molecular Weight: 259 aa, 29 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC020938 Gene Symbol: SYPL1 Gene ID (NCBI): 6856 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q16563 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.