Proteintech, 25152-1-AP, ZNF253 Polyclonal antibody

Size: 20ul / 150ul The ZNF253 (25152-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF253 in WB, ELISA applications with reactivity to human samples 25152-1-AP targets ZNF253 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, SMMC-7721 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Background Information ZNF253, also named as Zinc finger protein 411 or BMZF1, is a 499 amino acid protein, which contains one KRAB domain and eleven C2H2-type zinc fingers. ZNF253 belongs to the krueppel C2H2-type zinc-finger protein family and is expressed in bone marrow and in monocytic and immature erythroid cell lines. ZNF253 may function as a transcription factor. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18570 Product name: Recombinant human ZNF253 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 63-130 aa of BC125063 Sequence: LTMERHEMIAKPPVMSSHFAQDLWPENIQNSFQIGMLRRYEECRHDNLQLKKGCKSVGEHKVHKGGYN Predict reactive species Full Name: zinc finger protein 253 Calculated Molecular Weight: 499 aa, 58 kDa Observed Molecular Weight: 58-65 kDa GenBank Accession Number: BC125063 Gene Symbol: ZNF253 Gene ID (NCBI): 56242 RRID: AB_2879927 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75346 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.