Iright
BRAND / VENDOR: Proteintech

Proteintech, 25168-1-AP, HIVEP1 Polyclonal antibody

CATALOG NUMBER: 25168-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The HIVEP1 (25168-1-AP) by Proteintech is a Polyclonal antibody targeting HIVEP1 in IHC, ELISA applications with reactivity to human samples 25168-1-AP targets HIVEP1 in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human stomach tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information HIVEP1 (human immunodeficiency virus type I enhancer binding protein 1), also known as CIRIP (cirhin interaction protein), MBP-1 (major histocompatibility complex binding protein 1), ZNF40, CRYBP1 or PRDII-BF1 (positive regulatory domain II binding factor 1), is a 2718 amino acid DNA-binding protein, which contains five C2H2-type zinc fingers. HIVEP1 may also participate in T-cell activation and apoptosis. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18462 Product name: Recombinant human HIVEP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2366-2718 aa of BC140816 Sequence: TLQPTPGLPSPHTHLFSHLPLHSQQQSRTPYNMVPVGGIHVVPAGLTYSTFVPLQAGPVQLTIPAVSVVHRTLGTHRNTVTEVSGTTNPAGVAELSSVVPCIPIGQIRVPGLQNLSTPGLQSLPSLSMETVNIVGLANTNMAPQVHPPGLALNAVGLQVLTANPSSQSSPAPQAHIPGLQILNIALPTLIPSVSQVAVDAQGAPEMPASQSKACETQPKQTSVASANQVSRTESPQGLPTVQRENAKKVLNPPAPAGDHARLDGLSKMDTEKAASANHVKPKPELTSIQGQPASTSQPLLKAHSEVFTKPSGQQTLSPDRQVPRPTALPRRQPTVHFSDVSSDDDEDRLVIAT Predict reactive species Full Name: human immunodeficiency virus type I enhancer binding protein 1 Calculated Molecular Weight: 2718 aa, 297 kDa GenBank Accession Number: BC140816 Gene Symbol: HIVEP1 Gene ID (NCBI): 3096 RRID: AB_2879938 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P15822 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924