Iright
BRAND / VENDOR: Proteintech

Proteintech, 25188-1-AP, PFN3 Polyclonal antibody

CATALOG NUMBER: 25188-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The PFN3 (25188-1-AP) by Proteintech is a Polyclonal antibody targeting PFN3 in WB, ELISA applications with reactivity to human, mouse, rat samples 25188-1-AP targets PFN3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, rat testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information PFN3 also known as profilin-3, belongs to the profilin family, a family of actin-binding proteins that regulate the dynamics of actin in cells. PFN3 may be involved in spermatogenesis. (PMID: 11867228). Deletion or abnormal function of PFN3 may lead to male infertility, especially in disorders associated with abnormal sperm acrosome development (spherozoospermia)(PMID: 34869336). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18131 Product name: Recombinant human PFN3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-137 aa of BC132952 Sequence: MGDWKVYISAVLRDQRIDDVAIVGHADNSCVWASRPGGLLAAISPQEVGVLTGPDRHTFLQAGLSVGGRRCCVIRDHLLAEGDGVLDARTKGLDARAVCVGRAPRALLVLMGRRGVHGGILNKTVHELIRGLRMQGA Predict reactive species Full Name: profilin 3 Calculated Molecular Weight: 137 aa, 15 kDa Observed Molecular Weight: 14 kDa GenBank Accession Number: BC132952 Gene Symbol: PFN3 Gene ID (NCBI): 345456 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P60673 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924