Iright
BRAND / VENDOR: Proteintech

Proteintech, 25196-1-AP, ZCCHC6 Polyclonal antibody

CATALOG NUMBER: 25196-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ZCCHC6 (25196-1-AP) by Proteintech is a Polyclonal antibody targeting ZCCHC6 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 25196-1-AP targets ZCCHC6 in WB, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: PC-3 cells, HEK-293T cells, mouse brain tissue Positive IP detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information ZCCHC6 also named as KIAA1711 ,HS2 or TUT7 is a 1495 amino acid protein, which contains threes CCHC-type zinc fingers and two PAP-associated domains. A member of the DNA polymerase type-B-like family, ZCCHC6 as a uridylyltransferase that mediates RNA uridylation. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18240 Product name: Recombinant human ZCCHC6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-251 aa of BC032456 Sequence: MGDTAKPYFVKRTKDRGTMDDDDFRRGHPQQDYLIIDDHAKGHGSKMEKGLQKKKITPGNYGNTPRKGPCAVSSNPYAFKNPIYSQPAWMNDSHKDQSKRWLSDEHTGNSDNWREFKPGPRIPVINRQRKDSFQENEDGYRWQDTRGCRTVRRLFHKDLTSLETTSEMEAGSPENKKQRSRPRKPRKTRNEENEQDGDLEGPVIDESVLSTKELLGLQQAEERLKRDCIDRLKRRPRNYPTAKYTCRLCDV Predict reactive species Full Name: zinc finger, CCHC domain containing 6 Calculated Molecular Weight: 1495 aa, 171 kDa Observed Molecular Weight: 171 kDa GenBank Accession Number: BC032456 Gene Symbol: ZCCHC6 Gene ID (NCBI): 79670 RRID: AB_2879953 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5VYS8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924