Proteintech, 25203-1-AP, DDHD2 Polyclonal antibody

Size: 20ul / 150ul The DDHD2 (25203-1-AP) by Proteintech is a Polyclonal antibody targeting DDHD2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 25203-1-AP targets DDHD2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: rat brain tissue, mouse lung tissue, mouse testis tissue Positive IHC detected in: mouse brain tissue, mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information DDHD2, also known as KIAA0725p, is a member of the intracellular phospholipase A1 (PLA1) protein family which comprises a group of enzymes that hydrolyze the sn-1 ester bond of phospholipids, producing 2-acyl-lysophospholipids and fatty acids. DDHD2 prefers phosphatidic acid as substrate and has a role in efficient membrane trafficking from the Golgi apparatus to the plasma membrane. The gene of DDHD2 maps to chromosome 8p11.23, and encodes a 711-amino-acid protein with a calculated molecular mass of 81 kDa. It has been reported that DDHD2 immunoblot analysis of various tissue extracts revealed two bands of 90 and 85 kDa (PMID: 11788596). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18373 Product name: Recombinant human DDHD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 56-174 aa of BC010504 Sequence: MDQGDTPTLEEDLKKLQLSEFFDIFEKEKVDKEALALCTDRDLQEIGIPLGPRKKILNYFSTRKNSMGIKRPAPQPASGANIPKESEFCSSSNTRNGDYLDVGIGQVSVKYPRLIYKPE Predict reactive species Full Name: DDHD domain containing 2 Calculated Molecular Weight: 711 aa, 81 kDa Observed Molecular Weight: 80-90 kDa GenBank Accession Number: BC010504 Gene Symbol: DDHD2 Gene ID (NCBI): 23259 RRID: AB_2879957 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O94830 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.