Product Description
Size: 20ul / 150ul
The DAAM2 (25206-1-AP) by Proteintech is a Polyclonal antibody targeting DAAM2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples
25206-1-AP targets DAAM2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: mouse brain tissue, rat brain tissue, Transfected HEK-293 cells
Positive IHC detected in: mouse heart tissue, human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF/ICC detected in: HeLa cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:1000
Immunohistochemistry (IHC): IHC : 1:50-1:500
Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
Specification
Tested Reactivity: human, mouse, rat
Cited Reactivity: human, mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag18955 Product name: Recombinant human DAAM2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 4-55 aa of BC128388 Sequence: RKRSHHGLGFLCCFGGSDIPEINLRDNHPLQFMEFSSPIPNAEELNIRFAEL Predict reactive species
Full Name: dishevelled associated activator of morphogenesis 2
Calculated Molecular Weight: 1068 aa, 123 kDa
Observed Molecular Weight: 100-130 kDa
GenBank Accession Number: BC128388
Gene Symbol: DAAM2
Gene ID (NCBI): 23500
RRID: AB_2879959
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q86T65
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924