Iright
BRAND / VENDOR: Proteintech

Proteintech, 25218-1-AP, USE1 Polyclonal antibody

CATALOG NUMBER: 25218-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The USE1 (25218-1-AP) by Proteintech is a Polyclonal antibody targeting USE1 in WB, IHC, ELISA applications with reactivity to human samples 25218-1-AP targets USE1 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, Jurkat cells Positive IHC detected in: human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:100-1:400 Background Information USE1(Vesicle transport protein USE1) is also named as USE1L, p31 and belongs to the USE1 family. It may be an essential molecule involved in the maintenance of ER morphology (and its deficiency leads to ER stress-induced apoptosis). USE1 also participates in the degradative function of lysosomes. This protein has 3 isoforms produced by alternative splicing. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18587 Product name: Recombinant human USE1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-231 aa of BC008455 Sequence: MAASRLELNLVRLLSRCEAMAAEKRDPDEWRLEKYVGALEDMLQALKVHASKPASEVINEYSWKVDFLKGMLQAEKLTSSSEKALANQFLAPGRVPTTARERVPATKTVHLQSRARYTSEMRSELLGTDSAEPEMDVRKRTGVAGSQPVSEKQSAAELDLVLQRHQNLQEKLAEEMLGLARSLKTNTLAAQSVIKKDNQTLSHSLKMADQNLEKLKTESERLEQHTQKSVN Predict reactive species Full Name: unconventional SNARE in the ER 1 homolog (S. cerevisiae) Calculated Molecular Weight: 259 aa, 29 kDa Observed Molecular Weight: 29 kDa GenBank Accession Number: BC008455 Gene Symbol: USE1 Gene ID (NCBI): 55850 RRID: AB_2879966 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NZ43 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924