Iright
BRAND / VENDOR: Proteintech

Proteintech, 25219-1-AP, DACH2 Polyclonal antibody

CATALOG NUMBER: 25219-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The DACH2 (25219-1-AP) by Proteintech is a Polyclonal antibody targeting DACH2 in WB, ELISA applications with reactivity to human, mouse samples 25219-1-AP targets DACH2 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse heart tissue, HeLa cells, mouse eye tissue, mouse kidney tissue, NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information Dachshund homolog 2 (DACH2), is a 599 amino acid protein, which belongs to the DACH family. DACH2 localizes in the nucleus and as a transcription factor is involved in regulation of organogenesis. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18403 Product name: Recombinant human DACH2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 50-181 aa of BC114950 Sequence: KRSLGVLQENARLLTHAVPGLLSPGLITPTGITAAAMAEAMKLQKMKLMAMNTLQGNGSQNGTESEPDDLNSNTGGSESSWDKDKMQSPFAAPGPQHGIAHAALAGQPGIGGAPTLNPLQQNHLLTNRLDLP Predict reactive species Full Name: dachshund homolog 2 (Drosophila) Calculated Molecular Weight: 599 aa, 65 kDa Observed Molecular Weight: 65 kDa GenBank Accession Number: BC114950 Gene Symbol: DACH2 Gene ID (NCBI): 117154 RRID: AB_2879967 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96NX9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924