Iright
BRAND / VENDOR: Proteintech

Proteintech, 25222-1-AP, DTX4 Polyclonal antibody

CATALOG NUMBER: 25222-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The DTX4 (25222-1-AP) by Proteintech is a Polyclonal antibody targeting DTX4 in WB, IF/ICC, IF-P, ELISA applications with reactivity to human, mouse samples 25222-1-AP targets DTX4 in WB, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse kidney tissue Positive IF-P detected in: mouse embryo tissue Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information DTX4, also named as KIAA0937, RNF155, is a 619 amino acid protein, which belongs to the Deltex family. DTX4 as a regulator of Notch signaling, a signaling pathway involved in cell-cell communications that regulates a broad spectrum of cell-fate determinations. DTX4 functions as a ubiquitin ligase protein in vivo, mediating 'Lys48'-linked polyubiquitination and promoting degradation of TBK1, targeting to TBK1 requires interaction with NLRP4. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18415 Product name: Recombinant human DTX4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 51-213 aa of BC119011 Sequence: LDLIYPMVTGTLPKAQSWPVSPGPATSPPMSPCSCPQCVLVMSVKAAVVNGSTGPLQLPVTRKNMPPPGVVKLPPLPGSGAKPLDSTGTIRGPLKTAPSQVIRRQASSMPTGTTMGSPASPPGPNSKTGRVALATLNRTNLQRLAIAQSRVLIASGVPTVPVK Predict reactive species Full Name: deltex homolog 4 (Drosophila) Calculated Molecular Weight: 619 aa, 67 kDa Observed Molecular Weight: 67-70 kDa GenBank Accession Number: BC119011 Gene Symbol: DTX4 Gene ID (NCBI): 23220 RRID: AB_2879970 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y2E6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924