Proteintech, 25245-1-AP, SLC10A2/ASBT Polyclonal antibody

Size: 20ul / 150ul The SLC10A2/ASBT (25245-1-AP) by Proteintech is a Polyclonal antibody targeting SLC10A2/ASBT in WB, IP, ELISA applications with reactivity to human, mouse samples 25245-1-AP targets SLC10A2/ASBT in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse small intestine tissue Positive IP detected in: mouse kidney tissue Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information SLC10A2 also known as ASBT, ISBT, and NTCP2, is a sodium/bile acid cotransporter that is primarily responsible for the uptake of bile acids by apical cells in the distal ileum(PMID: 8661017). Mutations in SLC10A2 cause primary bile acid malabsorption (PBAM) and may be associated with other diseases of the liver and intestines, such as familial hypertriglyceridemia (FHTG)(PMID: 9109432). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat, hamster Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18808 Product name: Recombinant human SLC10A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 292-348 aa of BC130523 Sequence: IYSIFQLAFAAIFLGFYVAYKKCHGKNKAEIPESKENGTEPESSFYKANGGFQPDEK Predict reactive species Full Name: solute carrier family 10 (sodium/bile acid cotransporter family), member 2 Calculated Molecular Weight: 348 aa, 38 kDa Observed Molecular Weight: 38-40 kDa GenBank Accession Number: BC130523 Gene Symbol: ASBT Gene ID (NCBI): 6555 RRID: AB_2879986 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q12908 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.