Proteintech, 25258-1-AP, FAM20A Polyclonal antibody

Size: 20ul / 150ul The FAM20A (25258-1-AP) by Proteintech is a Polyclonal antibody targeting FAM20A in WB, IHC, ELISA applications with reactivity to human, mouse samples 25258-1-AP targets FAM20A in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse lung tissue Positive IHC detected in: human colon cancer tissue, human ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19494 Product name: Recombinant human FAM20A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 424-541 aa of BC136686 Sequence: GFLIHLDNARGFGRHSHDEISILSPLSQCCMIKKKTLLHLQLLAQADYRLSDVMRESLLEDQLSPVLTEPHLLALDRRLQTILRTVEGCIVAHGQQSVIVDGPVEQSAPDSGQANLTS Predict reactive species Full Name: family with sequence similarity 20, member A Calculated Molecular Weight: 541 aa, 61 kDa Observed Molecular Weight: 62 kDa GenBank Accession Number: BC136686 Gene Symbol: FAM20A Gene ID (NCBI): 54757 RRID: AB_2879991 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96MK3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.