Proteintech, 25260-1-AP, RNF123 Polyclonal antibody

Size: 20ul / 150ul The RNF123 (25260-1-AP) by Proteintech is a Polyclonal antibody targeting RNF123 in WB, IP, ELISA applications with reactivity to human samples 25260-1-AP targets RNF123 in WB, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, HEK-293 cells, HeLa cells, HuH-7 cells Positive IP detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information RING finger protein 123 (RNF123), also known as KPC1, is an E3 ubiquitin ligase that belongs to the RING-finger family of ligases that contain a 40-60-amino acid long RING domain which is essential for causing substrate ubiquitination (PMID: 29676528). RNF123 promoted TLR3/IRF7-induced type I IFN signaling and inhibited viral replication by degrading SOCS1 (PMID: 37014223). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19653 Product name: Recombinant human RNF123 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 12-358 aa of BC130632 Sequence: RKSYRLTSDAEKSRVTGIVQEKLLNDYLNRIFSSSEHAPPAATSRKPLNFQNLPEHLDQLLQVDNEEEESQGQVEGRLGPSTVVLDHTGGFEGLLLVDDDLLGVIGHSNFGTIRSTTCVYKGKWLYEVLISSQGLMQIGWCTISCRFNQEEGVGDTHNSYAYDGNRVRKWNVTTTNYGKAWAAGDIVSCLIDLDDGTLSFCLNGVSLGTAFENLSRGLGMAYFPAISLSFKESVAFNFGSRPLRYPVAGYRPLQDPPSADLVRAQRLLGCFRAVLSVELDPVEGRLLDKESSKWRLRGQPTVLLTLAHIFHHFAPLLRKVYLVEAVLMSFLLGIVEKGTPTQAQSVV Predict reactive species Full Name: ring finger protein 123 Calculated Molecular Weight: 1314 aa, 149 kDa Observed Molecular Weight: 149 kDa GenBank Accession Number: BC130632 Gene Symbol: RNF123 Gene ID (NCBI): 63891 RRID: AB_3669467 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5XPI4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.