Proteintech, 25297-1-AP, RBM25 Polyclonal antibody

Size: 20ul / 150ul The RBM25 (25297-1-AP) by Proteintech is a Polyclonal antibody targeting RBM25 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse samples 25297-1-AP targets RBM25 in WB, IHC, IF/ICC, IP, RIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, Jurkat cells, mouse brain tissue Positive IP detected in: HEK-293 cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:150-1:600 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information RNA-binding protein 25 (RBM25), also named as Protein S164 or RNPC7, is a 843 amino acid protein, which contains one RRM domain and one PWI domain. RBM25 localizes in the nucleus and cytoplasm. RBM25 acts as a regulator of alternative pre-mRNA splicing and is involved in apoptotic cell death through the regulation of the apoptotic factor BCL2L1 isoform expression. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18244 Product name: Recombinant human RBM25 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 605-839 aa of BC113389 Sequence: QKPCLKPTLRPISSAPSVSSASGNATPNTPGDESPCGIIIPHENSPDQQQPEEHRPKIGLSLKLGASNSPGQPNSVKRKKLPVDSVFNKFEDEDSDDVPRKRKLVPLDYGEDDKNATKGTVNTEEKRKHIKSLIEKIPTAKPELFAYPLDWSIVDSILMERRIRPWINKKIIEYIGEEEATLVDFVCSKVMAHSSPQSILDDVAMVLDEEAEVFIVKMWRLLIYETEAKKIGLVK Predict reactive species Full Name: RNA binding motif protein 25 Calculated Molecular Weight: 843 aa, 100 kDa Observed Molecular Weight: 110-120 kDa GenBank Accession Number: BC113389 Gene Symbol: RBM25 Gene ID (NCBI): 58517 RRID: AB_2880014 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P49756 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.