Product Description
Size: 20ul / 150ul
The ZNF460 (25299-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF460 in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples
25299-1-AP targets ZNF460 in WB, IHC, IF/ICC, ChIP, ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive WB detected in: A431 cells, HeLa cells, Jurkat cells, HepG2 cells
Positive IF/ICC detected in: HeLa cells
Recommended dilution
Western Blot (WB): WB : 1:1000-1:4000
Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
Specification
Tested Reactivity: human, mouse
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag18106 Product name: Recombinant human ZNF460 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 102-211 aa of BC118625 Sequence: MQEYFLRPGTDPQSEKLHGKMSLEHEGLATADGICSMMIQNQVSPEDALYGFDSYGPVTDSLIHEGENSYKFEEMFNENCFLVQHEQILPRVKPYDCPECGKAFGKSKHL Predict reactive species
Full Name: zinc finger protein 460
Calculated Molecular Weight: 562 aa, 64 kDa
Observed Molecular Weight: 65 kDa
GenBank Accession Number: BC118625
Gene Symbol: ZNF460
Gene ID (NCBI): 10794
RRID: AB_2880016
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q14592
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924