Iright
BRAND / VENDOR: Proteintech

Proteintech, 25309-1-AP, PIH1D3 Polyclonal antibody

CATALOG NUMBER: 25309-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The PIH1D3 (25309-1-AP) by Proteintech is a Polyclonal antibody targeting PIH1D3 in IHC, ELISA applications with reactivity to human samples 25309-1-AP targets PIH1D3 in WB, IF, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human lung tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human Cited Reactivity: rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15039 Product name: Recombinant human CXorf41 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-214 aa of BC033510 Sequence: MESENMDSENMKTENMESQNVDFESVSSVTALEALSKLLNPEEEDDSDYGQTNGLSTIGAMGPGNIGPPQIEELKVIPETSEENNEDIWNSEEIPEGAEYDDMWDVREIPEYEIIFRQQVGTEDIFLGLSKKDSSTGCCSELVAKIKLPNTNPSDIQIDIQETILDLRTPQKKLLITLPELVECTSAKAFYIPETETLEITMTMKRELDIANFF Predict reactive species Full Name: chromosome X open reading frame 41 Calculated Molecular Weight: 214 aa, 24 kDa GenBank Accession Number: BC033510 Gene Symbol: DNAAF6 Gene ID (NCBI): 139212 RRID: AB_2880024 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NQM4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924