Proteintech, 25315-1-AP, RUNX1 (middle) Polyclonal antibody

Size: 20ul / 150ul The RUNX1 (middle) (25315-1-AP) by Proteintech is a Polyclonal antibody targeting RUNX1 (middle) in WB, IF/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples 25315-1-AP targets RUNX1 (middle) in WB, IF/ICC, FC (Intra), IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse thymus tissue, Jurkat cells, Rat thymus tissue Positive IP detected in: Jurkat cells Positive IF/ICC detected in: U-251 cells Positive FC (Intra) detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Runt-related transcription factor 1 (RUNX1), also named AML1 or CBF alpha 2, is a 453 amino acid protein, which contains one Runt domain. RUNX1 localizes in the nucleus and is expressed in all tissues except the brain and heart. RUNX1 is involved in hematopoiesis and is frequently targeted in human leukemia by chromosomal translocations that fuse the DNA-binding domain of RUNX1 to other transcription factors and corepressor molecules. In addition to its role in leukemogenesis, RUNX1 is also involved in sensory neuron diversification. RUNX1 exists in some isoforms with a range of MV 20-52 kDa. The calculated molecular weight of isoform 1 is 49 kDa, but the modified protein is about 49-55 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig, zebrafish Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17838 Product name: Recombinant human RUNX1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 214-277 aa of BC136381 Sequence: TKPGSLSFSERLSELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFNPQPQSQMQDTRQIQPSP Predict reactive species Full Name: runt-related transcription factor 1 Calculated Molecular Weight: 480 aa, 52 kDa Observed Molecular Weight: 48-55 kDa GenBank Accession Number: BC136381 Gene Symbol: RUNX1 Gene ID (NCBI): 861 RRID: AB_2880026 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q01196 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.