Proteintech, 25321-1-AP, IQSEC2 Polyclonal antibody

Size: 20ul / 150ul The IQSEC2 (25321-1-AP) by Proteintech is a Polyclonal antibody targeting IQSEC2 in IHC, ELISA applications with reactivity to human samples 25321-1-AP targets IQSEC2 in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human kidney tissue, human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18226 Product name: Recombinant human IQSEC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 189-386 aa of BC156683 Sequence: FEEYEKAQNPAYFEGKPASLDEGAMAGARSHRLERGLPYGGSCGGGIDGGGSSVTTSGEFSNDITELEDSFSKQVKSLAESIDEALNCHPSGPMSEEPGSAQLEKRESKEQQEDSSATSFSDLPLYLDDTVPQQSPERLPSTEPPPQGRPEFWAPAPLPPVPPPVPSGTREDGSREEGTRRGPGCLECRDFRLRAAHL Predict reactive species Full Name: IQ motif and Sec7 domain 2 Calculated Molecular Weight: 1488 aa, 163 kDa GenBank Accession Number: BC156683 Gene Symbol: IQSEC2 Gene ID (NCBI): 23096 RRID: AB_2880030 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5JU85 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.