Iright
BRAND / VENDOR: Proteintech

Proteintech, 25351-1-AP, HECTD2 Polyclonal antibody

CATALOG NUMBER: 25351-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The HECTD2 (25351-1-AP) by Proteintech is a Polyclonal antibody targeting HECTD2 in WB, ELISA applications with reactivity to human, mouse samples 25351-1-AP targets HECTD2 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information HECTD2(HECT domain-containing protein 2) may be an E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. This protein has 2 isoforms produced by alternative splicing. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18360 Product name: Recombinant human HECTD2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 428-776 aa of BC040187 Sequence: SDSLDELTRKRADLKKKLKVTFVGEAGLDMGGLTKEWFLLLIRQIFHPDYGMFTYHKDSHCHWFSSFKCDNYSEFRLVGILMGLAVYNSITFDIRFPPCCYKKLLSPPIIPSGQNIPVGICNVTVDDLCQIMPELAHGLSELLSHEGNVEEDFYSTFQVFQEEFGIIKSYNLKPGGDKISVTNQNRKEYVQLYTDFLLNKSIYKQFAAFYYGFHSVCASNALMLLRPEEVEILVCGSPDLDMHALQRSTQYDGYAKTDLTIKYFWDVVLGFPLDLQKKLLHFTTGSDRVPVGGMADLNFKISKNETSTNCLPVAHTCFNQLCLPPYKSKKDLKQKLIIGISNSEGFGLE Predict reactive species Full Name: HECT domain containing 2 Calculated Molecular Weight: 776 aa, 88 kDa Observed Molecular Weight: 88 kDa GenBank Accession Number: BC040187 Gene Symbol: HECTD2 Gene ID (NCBI): 143279 RRID: AB_2880040 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5U5R9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924