Proteintech, 25353-1-AP, TNRC4 Polyclonal antibody

Size: 20ul / 150ul The TNRC4 (25353-1-AP) by Proteintech is a Polyclonal antibody targeting TNRC4 in WB, IHC, ELISA applications with reactivity to human, mouse samples 25353-1-AP targets TNRC4 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse lung tissue, mouse spleen tissue Positive IHC detected in: human testis tissue, human cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information TNRC4, also named as BRUNOL1, CAGH4, ERDA4, or TNRC4, is a 465 amino acid protein, which contains three RRM (RNA recognition motif) domains and belongs to the CELF/BRUNOL family. TNRC4 localizes in the nucleus and is expressed in brain. TNRC4 as a RNA-binding protein is involved in the regulation of pre-mRNA alternative splicing and mediates exon inclusion and/or exclusion in pre-mRNA that are subject to tissue-specific and developmentally regulated alternative splicing. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18601 Product name: Recombinant human TNRC4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 180-352 aa of BC052491 Sequence: GLRRMQQVATQLGMFSPITLQFGAYSAYTQALMQQQAALVAAHSAYLSPMATMAAVQMQHMAAINANGLIATPITPSSGTSTPPAIAATPVSAIPAALGVNGYSQVPTQPTGQPAPDALYPNGVHPYPAQSPAAPVDPLQQAYAGMQHYTAYPAAYSLVAPAFPQPPALVAQQ Predict reactive species Full Name: trinucleotide repeat containing 4 Calculated Molecular Weight: 464 aa, 51 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: BC052491 Gene Symbol: TNRC4 Gene ID (NCBI): 11189 RRID: AB_2880041 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5SZQ8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.