Proteintech, 25358-1-AP, MRP3/ABCC3 Polyclonal antibody

Size: 20ul / 150ul The MRP3/ABCC3 (25358-1-AP) by Proteintech is a Polyclonal antibody targeting MRP3/ABCC3 in WB, IHC, ELISA applications with reactivity to human samples 25358-1-AP targets MRP3/ABCC3 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: 37°C incubated HeLa cells Positive IHC detected in: human colon tissue, human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:400-1:1600 Background Information MRP3 also known as ABCC3, belongs to ATP-binding cassette (ABC) transporter protein superfamily. MRP3 hydrolyzes ATP to enable active transport of various substrates including many drugs, toxicants, and endogenous compounds across cell membranes (PMID: 11581266, 15083066). In normal liver, MRP3 was found present mainly in the bile ducts. In livers of patients with various forms of cholestasis, MRP3 levels were frequently increased in the proliferative cholangiocytes, suggesting its role in cholehepatic and enterohepatic bile circulation and in protecting liver from toxic bile salts( PMID: 11850532, 11283840). MRP3 is expressed in the liver, colon, pancreas, and, at a lower level, in the kidney (PMID:10094960). For optimal WB detection of this membrane protein, we recommend to avoid boiling the sample after lysis. Specification Tested Reactivity: human Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19786 Product name: Recombinant human ABCC3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 838-960 aa of BC137348 Sequence: LLQRNGSFANFLCNYAPDEDQGHLEDSWTALEGAEDKEALLIEDTLSNHTDLTDNDPVTYVVQKQFMRQLSALSSDGEGQGRPVPRRHLGPSEKVQVTEAKADGALTQEEKAAIGTVELSVFW Predict reactive species Full Name: ATP-binding cassette, sub-family C (CFTR/MRP), member 3 Calculated Molecular Weight: 1527 aa, 169 kDa Observed Molecular Weight: 170-180 kDa GenBank Accession Number: BC137348 Gene Symbol: MRP3 Gene ID (NCBI): 8714 RRID: AB_3085789 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O15438 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.