Iright
BRAND / VENDOR: Proteintech

Proteintech, 25362-1-AP, C3orf43 Polyclonal antibody

CATALOG NUMBER: 25362-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The C3orf43 (25362-1-AP) by Proteintech is a Polyclonal antibody targeting C3orf43 in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 25362-1-AP targets C3orf43 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse heart tissue, human plasma tissue Positive IF/ICC detected in: A431 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21670 Product name: Recombinant human C3orf43 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-214 aa of BC118636 Sequence: MNNETTTLISLKEAMKRVDHKLQALETQFKELDFTKDNLMQKFEHHSKALASQAAQDEMWTAVRALQLTSMELNILYSYVIEVLICLHTRVLEKLPDLVRGLPTLASVLRRKVKNKRVRVVWESILEECGLQEGDITALCTFFIARGNKAEHYTAKVRQMYIRDVTFLITNMVKNQALQDSLLRAVQVIEKGKAVRTPEKQKSSLEELIPSVKN Predict reactive species Full Name: chromosome 3 open reading frame 43 Calculated Molecular Weight: 214 aa, 25 kDa Observed Molecular Weight: 25-30 kDa GenBank Accession Number: BC118636 Gene Symbol: C3orf43 Gene ID (NCBI): 255798 RRID: AB_2880044 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q147U7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924