Iright
BRAND / VENDOR: Proteintech

Proteintech, 25367-1-AP, HIGD1B Polyclonal antibody

CATALOG NUMBER: 25367-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The HIGD1B (25367-1-AP) by Proteintech is a Polyclonal antibody targeting HIGD1B in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 25367-1-AP targets HIGD1B in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human placenta tissue Positive IHC detected in: rat heart tissue, human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information HIG1 domain family member 1B (HIGD1B) is localized to the cell membrane whose expression is induced by hypoxia and glucose deprivation. HIG1 domain family member 1B (HIGD1B) is localized to the cell membrane whose expression is induced by hypoxia and glucose deprivation. (PMID: 34026765) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21871 Product name: Recombinant human HIGD1B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-99 aa of BC020667 Sequence: MSANRRWWVPPDDEDCVSEKLLRKTRESPLVPIGLGGCLVVAAYRIYRLRSRGSTKMSIHLIHTRVAAQACAVGAIMLGAVYTMYSDYVKRMAQDAGEK Predict reactive species Full Name: HIG1 hypoxia inducible domain family, member 1B Calculated Molecular Weight: 99 aa, 11 kDa Observed Molecular Weight: 11 kDa GenBank Accession Number: BC020667 Gene Symbol: HIGD1B Gene ID (NCBI): 51751 RRID: AB_2880047 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9P298 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924