Proteintech, 25371-1-AP, REM2 Polyclonal antibody

Size: 20ul / 150ul The REM2 (25371-1-AP) by Proteintech is a Polyclonal antibody targeting REM2 in WB, ELISA applications with reactivity to human, mouse samples 25371-1-AP targets REM2 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: fetal human brain tissue, mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Rem2 is a member of the RGK subfamily of RAS small GTPases. Rem2 inhibits high voltage activated calcium channels, is involved in synaptogenesis, and regulates dendritic morphology. Rem2 is the primary RGK protein expressed in the nervous system, but to date, the precise expression patterns of this protein are unknown. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21991 Product name: Recombinant human REM2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-110 aa of BC035663 Sequence: MDTETTALCPSGSRRASPPGTPTPEADATLLKKSEKLLAELDRSGLPSAPGAPRRRGSMPVPYKHQLRRAQAVDELDWPPQASSSGSSDSLGSGEAAPAQKDGIFKVMLV Predict reactive species Full Name: RAS (RAD and GEM)-like GTP binding 2 Calculated Molecular Weight: 340 aa, 37 kDa Observed Molecular Weight: 37 kDa GenBank Accession Number: BC035663 Gene Symbol: REM2 Gene ID (NCBI): 161253 RRID: AB_2880049 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IYK8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.