Proteintech, 25381-1-AP, NUP62CL Polyclonal antibody

Size: 20ul / 150ul The NUP62CL (25381-1-AP) by Proteintech is a Polyclonal antibody targeting NUP62CL in WB, IHC, ELISA applications with reactivity to human samples 25381-1-AP targets NUP62CL in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells, SH-SY5Y cells Positive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21107 Product name: Recombinant human NUP62CL protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-72 aa of BC017799 Sequence: MQFTSISNSLTSTAAIGLSFTTSTTTTATFTTNTTTTITSGFTVNQNQLLSRGFENLVPYTSTVRFVFYMEK Predict reactive species Full Name: nucleoporin 62kDa C-terminal like Calculated Molecular Weight: 72 aa, 8 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC017799 Gene Symbol: NUP62CL Gene ID (NCBI): 54830 RRID: AB_2880051 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H1M0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.