Iright
BRAND / VENDOR: Proteintech

Proteintech, 25408-1-AP, C13orf27/TEX30 Polyclonal antibody

CATALOG NUMBER: 25408-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The C13orf27/TEX30 (25408-1-AP) by Proteintech is a Polyclonal antibody targeting C13orf27/TEX30 in WB, ELISA applications with reactivity to human, mouse samples 25408-1-AP targets C13orf27/TEX30 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: human testis tissue, mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22096 Product name: Recombinant human C13orf27 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-186 aa of BC015148 Sequence: MNLPHLMSLASHLASHGFFCLRFTCKGLNIVHRIKAYKSVLNYLKTSGEYKLAGVFLGGRSMGSRAAASVMCHIEPDDGDDFVRGLICISYPLHHPKQQHKLRDEDLFRLKEPVLFVSGSADEMCEKNLLEKVAQKMQAPHKIHWIEKANHSMAVKGRSTNDVFKEINTQILFWIQEITEMDKKCH Predict reactive species Full Name: chromosome 13 open reading frame 27 Calculated Molecular Weight: 227 aa, 26 kDa Observed Molecular Weight: 26 kDa GenBank Accession Number: BC015148 Gene Symbol: TEX30 Gene ID (NCBI): 93081 RRID: AB_2880064 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5JUR7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924