Iright
BRAND / VENDOR: Proteintech

Proteintech, 25409-1-AP, GAS2L3 Polyclonal antibody

CATALOG NUMBER: 25409-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The GAS2L3 (25409-1-AP) by Proteintech is a Polyclonal antibody targeting GAS2L3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 25409-1-AP targets GAS2L3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, mouse heart tissue, rat heart tissue Positive IHC detected in: rat heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information GAS2L3 also known as G2L3, belongs to the GAS2 family of four related proteins. It contains an N-terminal calponin homology (CH) domain and a C-terminal GAS2-related (GAR) domain, which are putative actin and microtubule binding domains. GAS2L3 is specifically expressed in mitosis and it localizes to the midbody and the constriction zone during cytokinesis (PMID: 28937871). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22097 Product name: Recombinant human GAS2L3 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 347-694 aa of BC043366 Sequence: GRPPGALVPASSLKGGNLGSMSVRSKLPNSPAASSHPKLKSSKGITKKPQAPSNNASSSLASLNPVGKNTSSPALPRTAPCISESPRKCISSPNTPKAKVIPAQNSADLPESTLLPNKCSGKTQPKYLKHNHISSRDNAVSHLAAHSNSSSKCPKLPKANIPVRPKPSFQSSAKMTKTSSKTIATGLGTQSQPSDGAPQAKPVPAQKLKSALNLNQPVSVSSVSPVKATQKSKDKNIVSATKKQPQNKSAFQKTGPSSLKSPGRTPLSIVSLPQSSTKTQTAPKSAQTVAKSQHSTKGPPRSGKTPASIRKPPSSVKDADSGDKKPTAKKKEDDDHYFVMTGSKKPRK Predict reactive species Full Name: growth arrest-specific 2 like 3 Calculated Molecular Weight: 694 aa, 75 kDa Observed Molecular Weight: 75 kDa GenBank Accession Number: BC043366 Gene Symbol: GAS2L3 Gene ID (NCBI): 283431 RRID: AB_3669473 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86XJ1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924