Iright
BRAND / VENDOR: Proteintech

Proteintech, 25414-1-AP, AFF2 Polyclonal antibody

CATALOG NUMBER: 25414-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The AFF2 (25414-1-AP) by Proteintech is a Polyclonal antibody targeting AFF2 in WB, IP, ELISA applications with reactivity to human samples 25414-1-AP targets AFF2 in WB, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: SH-SY5Y cells Positive IP detected in: SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information AFF2 (OMIM* 300806) (also known as FMR2 gene), which encodes AF4/FMR2 family member 2, is a transcriptional factor and RNA-binding protein that plays an important role in transcriptional regulation, RNA splicing, mRNA processing, and nuclear speckle organization . AFF2 is highly conserved and abundantly expressed in human brain, being essential for brain development. Homozygous AFF2 knock-out mice showed abnormal central nervous system synaptic transmission, abnormal excitatory postsynaptic potential, and premature death (PMID: 35431806). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22225 Product name: Recombinant human AFF2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 80-263 aa of BC132683 Sequence: LLTNHSNQNHLVGIPKNSVPQNPNNKNEPSFFPEQKNRIIPPHQDNTHPSAPMPPPSVVILNSTLIHSNRKSKPEWSRDSHNPSTVLASQASGQPNKMQTLTQDQSQAKLEDFFVYPAEQPQIGEVEESNPSAKEDSNPNSSGEDAFKEIFQSNSPEESEFAVQAPGSPLVASSLLAPSSGLSV Predict reactive species Full Name: AF4/FMR2 family, member 2 Calculated Molecular Weight: 1311 aa, 145 kDa Observed Molecular Weight: 145 kDa GenBank Accession Number: BC132683 Gene Symbol: AFF2 Gene ID (NCBI): 2334 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P51816 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924