Iright
BRAND / VENDOR: Proteintech

Proteintech, 25419-1-AP, KIAA0907 Polyclonal antibody

CATALOG NUMBER: 25419-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The KIAA0907 (25419-1-AP) by Proteintech is a Polyclonal antibody targeting KIAA0907 in WB, IHC, ELISA applications with reactivity to human, mouse samples 25419-1-AP targets KIAA0907 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A549 cells, PC-13 cells, mouse liver tissue, mouse small intestine tissue Positive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information KIAA0907, also named as BLOM7, is 614 amino acid protein, which belongs to the UPF0469 family. KIAA0907 exists as four alternative splicing isoforms and its residues is modified by phosphorylase. KIAA0907 are frequently observed in lung cancer cells. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22217 Product name: Recombinant human KIAA0907 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-226 aa of BC062637 Sequence: MSAGSATHPGAGGRRSKWDQPAPAPLLFLPPAAPGGEVTSSGGSPGGTTAAPSGALDAAAAVAAKINAMLMAKGKLKPTQNASEKLQAPGKGLTSNKSKDDLVVAEVEINDVPLTCRNLLTRGQTQDEISRLSGAAVSTRGRFMTTEEKAKVGPGDRPLYLHVQGQTRELVDRAVNRIKEIITNGVVKAATGTSPTFNGATVTVYHQPAPIAQLSPAVSQKPPFQS Predict reactive species Full Name: KIAA0907 Calculated Molecular Weight: 614 aa, 65 kDa Observed Molecular Weight: 68 kDa GenBank Accession Number: BC062637 Gene Symbol: KIAA0907 Gene ID (NCBI): 22889 RRID: AB_2880070 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q7Z7F0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924