Proteintech, 25422-1-AP, TTC32 Polyclonal antibody

Size: 20ul / 150ul The TTC32 (25422-1-AP) by Proteintech is a Polyclonal antibody targeting TTC32 in WB, IP, IHC, ELISA applications with reactivity to human, mouse samples 25422-1-AP targets TTC32 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse testis tissue Positive IP detected in: mouse testis tissue Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22115 Product name: Recombinant human TTC32 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-151 aa of BC057850 Sequence: MEGQRQESHATLTLAQAHFNNGEYAEAEALYSAYIRRCACAASSDESPGSKCSPEDLATAYNNRGQIKYFRVDFYEAMDDYTSAIEVQPNFEVPYYNRGLILYRLGYFDDALEDFKKVLDLNPGFQDATLSLKQTILDKEEKQRRNVAKNY Predict reactive species Full Name: tetratricopeptide repeat domain 32 Calculated Molecular Weight: 151 aa, 17 kDa Observed Molecular Weight: 17-30 kDa GenBank Accession Number: BC057850 Gene Symbol: TTC32 Gene ID (NCBI): 130502 RRID: AB_2880073 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5I0X7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.