Iright
BRAND / VENDOR: Proteintech

Proteintech, 25434-1-AP, KREMEN1 Polyclonal antibody

CATALOG NUMBER: 25434-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The KREMEN1 (25434-1-AP) by Proteintech is a Polyclonal antibody targeting KREMEN1 in WB, ELISA applications with reactivity to human, mouse, rat samples 25434-1-AP targets KREMEN1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, rat liver tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information Kringle containing transmembrane protein 1 (KREMEN1, also known as KRM1, ECTD13, and KREMEN) is a transmembrane receptor located in the membrane. During the development of various organs, including the nervous system, limbs, and liver, KREMEN1 synergizes with the Dkk proteins to inhibit Wnt signaling (PMID: 18505822). KREMEN1 has been reported as a tumor suppressor, preventing cancer cell survival in a ligand-poor environment (PMID: 31069116). Variations and mutations of KREMEN1 have been associated with ectodermal dysplasia and Hand-foot-and-mouth disease (PMID: 34028942; 31911601). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22092 Product name: Recombinant human KREMEN1 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 234-458 aa of BC063787 Sequence: DTYATGRVCYWTIRVPGASHIHFSFPLFDIRDSADMVELLDGYTHRVLARFHGRSRPPLSFNVSLDFVILYFFSDRINQAQGFAVLYQAVKEELPQERPAVNQTVAEVITEQANLSVSAARSSKVLYVITTSPSHPPQTVPGWTVYGLATLLILTVTAIVAKILLHVTFKSHRVPASGDLRDCHQPGTSGEIWSIFYKPSTSISIFKKKLKGQSQQDDRNPLVSD Predict reactive species Full Name: kringle containing transmembrane protein 1 Calculated Molecular Weight: 473 aa, 52 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC063787 Gene Symbol: KREMEN1 Gene ID (NCBI): 83999 RRID: AB_3669475 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96MU8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924