Proteintech, 25443-1-AP, TTC35 Polyclonal antibody

Size: 20ul / 150ul The TTC35 (25443-1-AP) by Proteintech is a Polyclonal antibody targeting TTC35 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 25443-1-AP targets TTC35 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells, human placenta tissue, K-562 cells, MCF-7 cells, mouse heart tissue, mouse spleen tissue, NIH/3T3 cells, PC-3 cells, SKOV-3 cells Positive IP detected in: mouse heart tissue Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information TPR repeat protein 35 (TTC35), also named as tetratricopeptide repeat domain 35, is a 297 amino acid protein, which contains three TPR repeats and belongs to the EMC2 family. TTC35 localizes in the nucleus and cytoplasm. TTC35 is a component of the ER membrane protein complex and may be a putative O-linked glycosyl transferase. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22196 Product name: Recombinant human TTC35 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-297 aa of BC021667 Sequence: MAKVSELYDVTWEEMRDKMRKWREENSRNSEQIVEVGEELINEYASKLGDDIWIIYEQVMIAALDYGRDDLALFCLQELRRQFPGSHRVKRLTGMRFEAMERYDDAIQLYDRILQEDPTNTAARKRKIAIRKAQGKNVEAIRELNEYLEQFVGDQEAWHELAELYINEHDYAKAAFCLEELMMTNPHNHLYCQQYAEVKYTQGGLENLELSRKYFAQALKLNNRNMRALFGLYMSASHIASNPKASAKTKKDNMKYASWAASQINRAYQFAGRSKKETKYSLKAVEDMLETLQITQS Predict reactive species Full Name: tetratricopeptide repeat domain 35 Calculated Molecular Weight: 297 aa, 35 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: BC021667 Gene Symbol: TTC35 Gene ID (NCBI): 9694 RRID: AB_2750836 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15006 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.