Iright
BRAND / VENDOR: Proteintech

Proteintech, 25450-1-AP, DCLK2 Polyclonal antibody

CATALOG NUMBER: 25450-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The DCLK2 (25450-1-AP) by Proteintech is a Polyclonal antibody targeting DCLK2 in WB, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 25450-1-AP targets DCLK2 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IP detected in: mouse brain tissue Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information DCLK2 belongs to the protein kinase superfamily, contains two N-terminal doublecortin domains, a C-terminal serine/threonine protein kinase domain, and a serine/proline-rich domain in between the doublecortin and the protein kinase domains. DCLK2 is expressed in the brain, heart and eyes (PMID: 18075264). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22142 Product name: Recombinant human DCLK2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 6-71 aa of BC032726 Sequence: MLQVNVEARCTAGQILSHPWVSDDASQENNMQAEVTGKLKQHFNNALPKQNSTTTGVSVIMFDLTV Predict reactive species Full Name: doublecortin-like kinase 2 Calculated Molecular Weight: 766 aa, 84 kDa Observed Molecular Weight: 83 kDa GenBank Accession Number: BC032726 Gene Symbol: DCLK2 Gene ID (NCBI): 166614 RRID: AB_3085796 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N568 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924