Iright
BRAND / VENDOR: Proteintech

Proteintech, 25471-1-AP, STK10 Polyclonal antibody

CATALOG NUMBER: 25471-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The STK10 (25471-1-AP) by Proteintech is a Polyclonal antibody targeting STK10 in WB, IHC, ELISA applications with reactivity to human samples 25471-1-AP targets STK10 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: SKOV-3 cells, A549 cells, COLO 320 cells Positive IHC detected in: human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Lymphocyte-oriented kinase deficiency encoded by the serine/threonine kinase 10 (STK10) gene correlates with the intracellular adhesion molecule 1 (ICAM-1)/lymphocyte function associated antigen 1 (LFA-1) complex in aspirin hypersensitivity(PMID:21905501). STK 10 is also named as LOK and expressed as a 130-kDa protein, which was detected predominantly in lymphoid organs such as spleen, thymus, and bone marrow, in contrast to other mammalian members of the STE20 family(PMID:9278426). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22169 Product name: Recombinant human STK10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 369-519 aa of BC070077 Sequence: SQSQDSVNEPCSQPSGDRSLQTTSPPVVAPGNENGLAVPVPLRKSRPVSMDARIQVAQEKQVAEQGGDLSPAANRSQKASQSRPNSSALETLGGEKLANGSLEPPAQAAPGPSKRDSDCSSLCTSESMDYGTNLSTDLSLNKEMGSLSIKD Predict reactive species Full Name: serine/threonine kinase 10 Calculated Molecular Weight: 968 aa, 112 kDa Observed Molecular Weight: 130 kDa GenBank Accession Number: BC070077 Gene Symbol: STK10 Gene ID (NCBI): 6793 RRID: AB_2880096 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O94804 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924