Proteintech, 25489-1-AP, TMEM199 Polyclonal antibody

Size: 20ul / 150ul The TMEM199 (25489-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM199 in WB, IHC, ELISA applications with reactivity to human, mouse samples 25489-1-AP targets TMEM199 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: NIH/3T3 cells Positive IHC detected in: human breast cancer tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information TMEM199, also named as C17orf32, is a component of the complex sense antisense architecture (CSAGA). Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22009 Product name: Recombinant human TMEM199 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-208 aa of BC033113 Sequence: MASSLLAGERLVRALGPGGELEPERLPRKLRAELEAALGKKHKGGDSSSGPQRLVSFRLIRDLHQHLRERDSKLYLHELLEGSEIYLPEVVKPPRNPELVARLEKIKIQLANEEYKRITRNVTCQDTRHGGTLSDLGKQVRSLKALVITIFNFIVTVVAAFVCTYLGSQYIFTEMASRVLAALIVASVVGLAELYVMVRAMEGELGEL Predict reactive species Full Name: transmembrane protein 199 Calculated Molecular Weight: 208 aa, 23 kDa Observed Molecular Weight: 18-23 kDa GenBank Accession Number: BC033113 Gene Symbol: TMEM199 Gene ID (NCBI): 147007 RRID: AB_2880101 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N511 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.