Proteintech, 25508-1-AP, LYPD6B Polyclonal antibody

Size: 20ul / 150ul The LYPD6B (25508-1-AP) by Proteintech is a Polyclonal antibody targeting LYPD6B in IHC, ELISA applications with reactivity to human, mouse samples 25508-1-AP targets LYPD6B in IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information LYPD6B (containing the Ly6/PLAUR domain protein 6B), also known as LYPD7, is a member of the Ly6/uPAR superfamily of proteins. These proteins typically exhibit membrane-anchoring properties and participate in critical cellular signaling and adhesion processes. It is predominantly expressed in the central nervous system. LYPD6B functions as a key regulatory subunit that interacts with and modulates nicotinic acetylcholine receptors (nAChRs), specifically influencing their maturation, stability, and functional properties at synapses. This interaction is crucial for normal cholinergic signaling, which underpins cognitive functions such as learning and memory. Dysfunction of the LYPD6B is associated with multiple neurological disorders. (PMID: 23186997, PMID: 34631692, PMID: 39433742) Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22008 Product name: Recombinant human LYPD6B protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-83 aa of BC040176 Sequence: MLLITLSANLFTVPERSLTTTFSFSRYKSSDRPAHKVSMLLLCHALAIAVVQIVIFSESWAFAKNINFYNVRPPLDPTPFPNS Predict reactive species Full Name: LY6/PLAUR domain containing 6B Calculated Molecular Weight: 183 aa, 20 kDa GenBank Accession Number: BC040176 Gene Symbol: LYPD6B Gene ID (NCBI): 130576 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NI32 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.