Proteintech, 25517-1-AP, NPB Polyclonal antibody

Size: 20ul / 150ul The NPB (25517-1-AP) by Proteintech is a Polyclonal antibody targeting NPB in IHC, ELISA applications with reactivity to human samples 25517-1-AP targets NPB in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human brain tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information Neuropeptide B, also named as NPB, PPL7 and PPNBP, can be cleaved into two chains, Neuropeptide B-23 (NPB23, hL7) and Neuropeptide B-29 (NPB29, hL7C). It is involved in the regulation of feeding, neuroendocrine system, memory, learning and in the afferent pain pathway. It is widely expressed in central nervous system. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21877 Product name: Recombinant human NPB protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 53-125 aa of BC126128 Sequence: ARRSQPYRGAEPPGGAGASPELQLHPRLRSLAVCVQDVAPNLQRCERLPDGRGTYQCKANVFLSLRAADCLAA Predict reactive species Full Name: neuropeptide B Calculated Molecular Weight: 125 aa, 13 kDa Observed Molecular Weight: ~10 kDa GenBank Accession Number: BC126128 Gene Symbol: NPB Gene ID (NCBI): 256933 RRID: AB_2880114 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NG41 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.