Iright
BRAND / VENDOR: Proteintech

Proteintech, 25525-1-AP, CHORDC1 Polyclonal antibody

CATALOG NUMBER: 25525-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CHORDC1 (25525-1-AP) by Proteintech is a Polyclonal antibody targeting CHORDC1 in WB, IF/ICC, ELISA applications with reactivity to human samples 25525-1-AP targets CHORDC1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, K-562 cells Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18315 Product name: Recombinant human CHORDC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-332 aa of BC072461 Sequence: MALLCYNRGCGQRFDPETNSDDACTYHPGVPVFHDALKGWSCCKRRTTDFSDFLSIVGCTKGRHNSEKPPEPVKPEVKTTEKKELCELKPKFQEHIIQAPKPVEAIKRPSPDEPMTNLELKISASLKQALDKLKLSSGNEENKKEEDNDEIKIGTSCKNGGCSKTYQGLESLEEVCVYHSGVPIFHEGMKYWSCCRRKTSDFNTFLAQEGCTKGKHMWTKKDAGKKVVPCRHDWHQTGGEVTISVYAKNSLPELSRVEANSTLLNVHIVFEGEKEFDQNVKLWGVIDVKRSYVTMTATKIEITMRKAEPMQWASLELPAAKKQEKQKDATTD Predict reactive species Full Name: cysteine and histidine-rich domain (CHORD)-containing 1 Calculated Molecular Weight: 332 aa, 37 kDa Observed Molecular Weight: 37 kDa GenBank Accession Number: BC072461 Gene Symbol: CHORDC1 Gene ID (NCBI): 26973 RRID: AB_2918091 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UHD1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924