Proteintech, 25529-1-AP, C7orf26 Polyclonal antibody

Size: 20ul / 150ul The C7orf26 (25529-1-AP) by Proteintech is a Polyclonal antibody targeting C7orf26 in IHC, ELISA applications with reactivity to human, mouse samples 25529-1-AP targets C7orf26 in IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: human liver cancer tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12678 Product name: Recombinant human C7orf26 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-180 aa of BC001076 Sequence: MSDIRHSLLRRDALSAAKEVLYHLDIYFSSQLQSAPLPIVDKGPVELLEEFVFQVPKERSAQPKEQTKDSVRQIIFSSLFSPQGNKADDSRMSLLGKLVSMAVAVCRIPVLECAASWLQRTPVVYCVRLAKALVDDYCCLVPGSIQTLKQIFSASPRFCCQFITSVTALYDLSSDDLIPP Predict reactive species Full Name: chromosome 7 open reading frame 26 Calculated Molecular Weight: 50 kDa Observed Molecular Weight: 40 kDa, 50 kDa GenBank Accession Number: BC001076 Gene Symbol: C7orf26 Gene ID (NCBI): 79034 RRID: AB_2880121 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96N11 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.