Proteintech, 25535-1-AP, DLL3 Polyclonal antibody

Size: 20ul / 150ul The DLL3 (25535-1-AP) by Proteintech is a Polyclonal antibody targeting DLL3 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 25535-1-AP targets DLL3 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, rat brain tissue Positive IHC detected in: human liver tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information The Delta-Notch pathway is an evolutionarily conserved signaling pathway which controls a broad range of developmental processes including cell fate determination, terminal differentiation and proliferation (PMID: 22353464). In mammals, four Notch receptors (NOTCH1-4) and five activating canonical ligands (JAGGED1, JAGGED2, DLL1, DLL3 and DLL4) have been described (PMID: 22353464). DLL3 is an inhibitory ligand of the Notch signaling pathway that is predominantly localizes to the Golgi apparatus (PMID: 17664336) in normal condition. Normal tissue expression of DLL3 is highest in fetal brain, and DLL3 plays a key role in somitogenesis in the paraxial mesoderm (PMID: 26311731). It has been reported that DLL3 is expressed on the surface of tumor cells of small cell lung cancer (SCLC) and high-grade neuroendocrine carcinomas (LCNEC) and has emerged as a novel therapeutic target (PMID: 26311731; 28487384). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21965 Product name: Recombinant human DLL3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 241-472 aa of BC000218 Sequence: EGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDGNPCANGGSCSETPRSFECTCPRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDG Predict reactive species Full Name: delta-like 3 (Drosophila) Calculated Molecular Weight: 65 kDa Observed Molecular Weight: 65-70 kDa GenBank Accession Number: BC000218 Gene Symbol: DLL3 Gene ID (NCBI): 10683 RRID: AB_2880122 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NYJ7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.