Iright
BRAND / VENDOR: Proteintech

Proteintech, 25536-1-AP, TMEM115 Polyclonal antibody

CATALOG NUMBER: 25536-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The TMEM115 (25536-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM115 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 25536-1-AP targets TMEM115 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: U2OS cells, mouse skeletal muscle tissue, rat skeletal muscle tissue Positive IHC detected in: human ovary cancer tissue, human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information TMEM115 also known as PL6, located on chromosome 3p21.3, was originally thought to function as a tumor suppressor. TMEM115 is an integral membrane protein of the Golgi complex involved in retrograde transport. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22258 Product name: Recombinant human TMEM115 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 233-351 aa of BC017367 Sequence: QPVVGLLANLVHSLLVKVKICQKTVKRYDVGAPSSITISLPGTDPQDAERRRQLALKALNERLKRVEDQSIWPSMDDDEEESGAKVDSPLPSDKAPTPPGKGAAPESSLITFEAAPPTL Predict reactive species Full Name: transmembrane protein 115 Calculated Molecular Weight: 351 aa, 38 kDa Observed Molecular Weight: 35-38 kDa GenBank Accession Number: BC017367 Gene Symbol: TMEM115 Gene ID (NCBI): 11070 RRID: AB_3669482 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q12893 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924