Proteintech, 25538-1-AP, MPP4 Polyclonal antibody

Size: 20ul / 150ul The MPP4 (25538-1-AP) by Proteintech is a Polyclonal antibody targeting MPP4 in WB, ELISA applications with reactivity to human, mouse samples 25538-1-AP targets MPP4 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse retina tissue Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Background Information MPP4 (Membrane protein palmitoylated 4), also named as DLG6, belongs to the MAGUK family which interact with the cytoskeleton and regulate cell proliferation, signaling pathways, and intracellular junctions. MPP4 is a retina-specific scaffolding protein hat plays an important role in signal transmission at the photoreceptor synapse (PMID: 18955048). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22235 Product name: Recombinant human MPP4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-131 aa of BC132785 Sequence: MIQSDKGADPPDKKDMKLSTATNPQNGLSQILRLVLQELSLFYSRDVNGVCLLYDLLHSPWLQALLKIYDCLQEFKEKKLVPATPHAQVLSYEVVELLRETPTSPEIQELRQMLQAPHFKALLSAHDTIAQ Predict reactive species Full Name: membrane protein, palmitoylated 4 (MAGUK p55 subfamily member 4) Calculated Molecular Weight: 630 aa, 72 kDa Observed Molecular Weight: 73 kDa GenBank Accession Number: BC132785 Gene Symbol: MPP4 Gene ID (NCBI): 58538 RRID: AB_3085803 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96JB8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.