Proteintech, 25544-1-AP, SCML2 Polyclonal antibody

Size: 20ul / 150ul The SCML2 (25544-1-AP) by Proteintech is a Polyclonal antibody targeting SCML2 in WB, IF/ICC, IP, ELISA applications with reactivity to human, mouse samples 25544-1-AP targets SCML2 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, mouse testis tissue, K-562 cells Positive IP detected in: HEK-293 cells Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information The human SCML2 gene, a mammalian homologue of the Drosophila PcG protein SCM, encodes two protein isoforms: SCML2A that is bound to chromatin and SCML2B that is predominantly nucleoplasmic (PMID: 24358021). Polycomb repressive complex-1 (PRC1) is essential for the epigenetic regulation of gene expression. SCML2 is a Polycomb-group protein that associates with PRC1. SCML2 participates in the epigenetic control of transcription directly and in cooperation with PRC1 (PMID: 24986859). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22271 Product name: Recombinant human SCML2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 563-649 aa of BC064617 Sequence: MYIHTSVSQDFSRSVPGTTSSPLVGDISPKSSPHEVKFQMQRKSEAPSYIAVPDPSVLKQGFSKDPSTWSVDEVIQFMKHTDPQISG Predict reactive species Full Name: sex comb on midleg-like 2 (Drosophila) Calculated Molecular Weight: 700 aa, 77 kDa Observed Molecular Weight: 70 kDa, 80 kDa GenBank Accession Number: BC064617 Gene Symbol: SCML2 Gene ID (NCBI): 10389 RRID: AB_2880127 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UQR0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.