Proteintech, 25552-1-AP, C1orf109 Polyclonal antibody

Size: 20ul / 150ul The C1orf109 (25552-1-AP) by Proteintech is a Polyclonal antibody targeting C1orf109 in WB, ELISA applications with reactivity to human samples 25552-1-AP targets C1orf109 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells, LNCaP cells, U-251 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22147 Product name: Recombinant human C1orf109 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-113 aa of BC018109 Sequence: MTQDRPLLAVQEALKKCFPVVEEQQGLWQSALRDCQPLLSSLSNLAEQLQAAQNLRFEDVPALRAFPDLKERLRQPSSSRCETWSAAMWSECFRSMSNTQTQLALMLSCSLQQ Predict reactive species Full Name: chromosome 1 open reading frame 109 Calculated Molecular Weight: 203 aa, 23 kDa Observed Molecular Weight: 23 kDa GenBank Accession Number: BC018109 Gene Symbol: C1orf109 Gene ID (NCBI): 54955 RRID: AB_3669483 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NX04 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.